PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 311aa    MW: 35503.1 Da    PI: 5.6875
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43346.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36e-092492822255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  KHN43346.1 249 WPYPTEEEKVKLSEITGLDQKQINNWFINQRKRH 282
                 58*****************************885 PP

2ELK301.2e-10202223122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 +LK++LlrKYsg+ ++L++EF+
  KHN43346.1 202 RLKEMLLRKYSGHFSGLRKEFL 223
                 69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-2057101IPR005540KNOX1
PfamPF037905.8E-2159100IPR005540KNOX1
SMARTSM012564.8E-23104155IPR005541KNOX2
PfamPF037911.0E-22108154IPR005541KNOX2
SMARTSM011883.7E-5202223IPR005539ELK domain
PROSITE profilePS512139.62202222IPR005539ELK domain
PfamPF037891.2E-8202223IPR005539ELK domain
PROSITE profilePS5007112.406222285IPR001356Homeobox domain
SMARTSM003891.6E-13224289IPR001356Homeobox domain
SuperFamilySSF466895.99E-19224294IPR009057Homeodomain-like
CDDcd000867.53E-13225285No hitNo description
Gene3DG3DSA:1.10.10.606.2E-26227287IPR009057Homeodomain-like
PfamPF059205.2E-16242281IPR008422Homeobox KN domain
PROSITE patternPS000270260283IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEAVYRLKPL LDVVRVGNAT TSEMRLESTA NCYLQLEAPQ PQENNNVTDS SSDMSDRIIK  60
IQIANHPLYP DLLSAYIECQ KVGAPPELAC LLEEIGRESH RMNARREIGE GPELDHFMET  120
FCQVLHRYKE ELSRPFNEAT LFLGDMESQL SNLCNETLTK SSDNNNRSDE VASGASEEEL  180
SCGEMEAFED NVSSVTCPSD QRLKEMLLRK YSGHFSGLRK EFLKRRKKGK LPKDARMALM  240
GWWNTHHRWP YPTEEEKVKL SEITGLDQKQ INNWFINQRK RHWKPTEDMR FAVMDGLRGG  300
GGGGIGGPML F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0959740.0BT095974.1 Soybean clone JCVI-FLGm-20M5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001239748.10.0uncharacterized protein LOC100803095
RefseqXP_006603727.10.0PREDICTED: uncharacterized protein LOC100803095 isoform X1
SwissprotQ9FP291e-91KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0B2S9G70.0A0A0B2S9G7_GLYSO; Homeobox protein knotted-1-like 1
TrEMBLC6TEF20.0C6TEF2_SOYBN; Uncharacterized protein
STRINGGLYMA19G41610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.16e-85KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]